SCOPe 2.03: Domain d1qppb1: 1qpp B:1-122

Lineage for d1qppb1 (1qpp B:1-122)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (14 PDB entries)

8. Domain d1qppb1: 1qpp B:1-122 [22321]
   Other proteins in same PDB: d1qppa2, d1qppb2

Details for d1qppb1

PDB Entry: 1qpp, 2.6 Å

PDB Description: crystal structures of self capping papd chaperone homodimers

PDB Compounds: (B:) papd chaperone

SCOPe Domain Sequences for d1qppb1:

Sequence; same for both SEQRES and ATOM records:

>d1qppb1 b.1.11.1 (B:1-122) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtaavfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
kt

Timeline for d1qppb1:

• d1qppb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qppb1 appears in SCOPe 2.02
  
• d1qppb1 appears in SCOPe 2.04
  
• d1qppb1 appears in the current release, SCOPe 2.08