SCOPe 2.04: Domain d3dbxa1: 3dbx A:7-187

Lineage for d3dbxa1 (3dbx A:7-187)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries)

8. Domain d3dbxa1: 3dbx A:7-187 [231988]
   Other proteins in same PDB: d3dbxa2, d3dbxb_
   automated match to d3jvga1
   complexed with nag, plm

Details for d3dbxa1

PDB Entry: 3dbx, 2 Å

PDB Description: structure of chicken cd1-2 with bound fatty acid

PDB Compounds: (A:) CD1-2 antigen

SCOPe Domain Sequences for d3dbxa1:

Sequence; same for both SEQRES and ATOM records:

>d3dbxa1 d.19.1.0 (A:7-187) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
peesqffqlfytlllgnvssteltgmalladvpimvldphtwnlnicrpwvqeitaetev
kkilsfsmvgirntirfmhemtakagldyprvfqihtgcklytngtrwsfvnigeggrdl
vtyelsrerwvpqrstllakvmsntltdlravsgflehifsssfpnyilmlheegrtdle
r

Timeline for d3dbxa1:

• d3dbxa1 first appeared in SCOPe 2.03
  
• d3dbxa1 appears in SCOPe 2.05
  
• d3dbxa1 appears in the current release, SCOPe 2.08