Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries) |
Domain d3dbxa1: 3dbx A:7-187 [231988] Other proteins in same PDB: d3dbxa2, d3dbxb_ automated match to d3jvga1 complexed with nag, plm |
PDB Entry: 3dbx (more details), 2 Å
SCOPe Domain Sequences for d3dbxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbxa1 d.19.1.0 (A:7-187) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} peesqffqlfytlllgnvssteltgmalladvpimvldphtwnlnicrpwvqeitaetev kkilsfsmvgirntirfmhemtakagldyprvfqihtgcklytngtrwsfvnigeggrdl vtyelsrerwvpqrstllakvmsntltdlravsgflehifsssfpnyilmlheegrtdle r
Timeline for d3dbxa1: