Lineage for d3crkc_ (3crk C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560128Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1560129Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 1560141Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 1560150Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)
  8. 1560151Domain d3crkc_: 3crk C: [231902]
    automated match to d2q8ib_
    complexed with k

Details for d3crkc_

PDB Entry: 3crk (more details), 2.3 Å

PDB Description: crystal structure of the pdhk2-l2 complex.
PDB Compounds: (C:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d3crkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crkc_ b.84.1.1 (C:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadi

SCOPe Domain Coordinates for d3crkc_:

Click to download the PDB-style file with coordinates for d3crkc_.
(The format of our PDB-style files is described here.)

Timeline for d3crkc_: