![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
![]() | Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
![]() | Family a.157.1.0: automated matches [227205] (1 protein) not a true family |
![]() | Protein automated matches [226937] (1 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (5 PDB entries) |
![]() | Domain d3c6na_: 3c6n A: [231879] automated match to d2p1ma2 complexed with 2s8, ihp |
PDB Entry: 3c6n (more details), 2.6 Å
SCOPe Domain Sequences for d3c6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c6na_ a.157.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} aanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe
Timeline for d3c6na_: