SCOPe 2.06: Domain d3apsb_: 3aps B:

Lineage for d3apsb_ (3aps B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (12 PDB entries)

8. Domain d3apsb_: 3aps B: [231807]
   automated match to d3uj1a_
   complexed with gol, so4

Details for d3apsb_

PDB Entry: 3aps, 1.9 Å

PDB Description: Crystal structure of Trx4 domain of ERdj5

PDB Compounds: (B:) DnaJ homolog subfamily C member 10

SCOPe Domain Sequences for d3apsb_:

Sequence; same for both SEQRES and ATOM records:

>d3apsb_ c.47.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pqasidltpqtfnekvlqgkthwvvdfyapwcgpcqnfapefellarmikgkvragkvdc
qaypqtcqkagikaypsvklyqyerakksiweeqinsrdaktiaaliygkletl

Timeline for d3apsb_:

• d3apsb_ first appeared in SCOPe 2.03
  
• d3apsb_ appears in SCOPe 2.05
  
• d3apsb_ appears in SCOPe 2.07
  
• d3apsb_ appears in the current release, SCOPe 2.08