![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
![]() | Protein Domain from cytosolic phospholipase A2 [49566] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49567] (3 PDB entries) |
![]() | Domain d1cjyb1: 1cjy B:1015-1141 [23179] Other proteins in same PDB: d1cjya2, d1cjyb2 complexed with ca, mes |
PDB Entry: 1cjy (more details), 2.5 Å
SCOPe Domain Sequences for d1cjyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjyb1 b.7.1.1 (B:1015-1141) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} qyshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnet fefildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlem slevcsc
Timeline for d1cjyb1: