Lineage for d1cjyb2 (1cjy B:1142-1717)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101353Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest
  4. 2101354Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) (S)
  5. 2101381Family c.19.1.2: Lysophospholipase [53645] (1 protein)
    common core is decorated with many additional structures; mixed beta-sheet of 9 strands, order 654321798; strands 4, 6 and 8 are antiparallel to the rest
    automatically mapped to Pfam PF01735
  6. 2101382Protein Cytosolic phospholipase A2 catalytic domain [53646] (1 species)
  7. 2101383Species Human (Homo sapiens) [TaxId:9606] [53647] (1 PDB entry)
  8. 2101385Domain d1cjyb2: 1cjy B:1142-1717 [34987]
    Other proteins in same PDB: d1cjya1, d1cjyb1
    complexed with ca, mes

Details for d1cjyb2

PDB Entry: 1cjy (more details), 2.5 Å

PDB Description: human cytosolic phospholipase a2
PDB Compounds: (B:) protein (cytosolic phospholipase a2)

SCOPe Domain Sequences for d1cjyb2:

Sequence, based on SEQRES records: (download)

>d1cjyb2 c.19.1.2 (B:1142-1717) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvailgsgggfra
mvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeeineelmknvsh
nplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttlsslkekvnt
aqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskffmgtvvkky
eenplhflmgvwgsafsilfnrvlgvsgsqsrgstmeeelenittkhivsndssdsddes
hepkgtenedagsdyqsdnqaswihrmimalvsdsalfntregragkvhnfmlglnlnts
yplsplsdfatqdsfdddeldaavadpdeferiyepldvkskkihvvdsgltfnlpypli
lrpqrgvdliisfdfsarpsdssppfkelllaekwakmnklpfpkidpyvfdreglkecy
vfkpknpdmekdcptiihfvlaninfrkykapgvpreteeekeiadfdifddpespfstf
nfqypnqafkrlhdlmhfntlnnidvikeamvesie

Sequence, based on observed residues (ATOM records): (download)

>d1cjyb2 c.19.1.2 (B:1142-1717) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvailgsgggfra
mvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeeineelmknvsh
nplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttlsslkekvnt
aqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskffmgtvvkky
eenplhflmgvwgsafsilfnrvlgstmeeelenittkhivswihrmimalvsdsalfnt
regragkvhnfmlglndvkskkihvvdsgltfnlpyplilrpqrgvdliisfdfsarpsd
ssppfkelllaekwakmnklpfpkidpyvfdreglkecyvfkpdcptiihfvlaninfrk
yapgvpreteeekeiadfdifddpespfstfnfqypnqafkrlhdlmhfntlnnidvike
amvesie

SCOPe Domain Coordinates for d1cjyb2:

Click to download the PDB-style file with coordinates for d1cjyb2.
(The format of our PDB-style files is described here.)

Timeline for d1cjyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjyb1