Lineage for d3a8ic2 (3a8i C:277-363)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317759Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317856Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 1317881Family b.44.2.0: automated matches [231768] (1 protein)
    not a true family
  6. 1317882Protein automated matches [231769] (1 species)
    not a true protein
  7. 1317883Species Escherichia coli [TaxId:83333] [231770] (2 PDB entries)
  8. 1317890Domain d3a8ic2: 3a8i C:277-363 [231775]
    Other proteins in same PDB: d3a8ia1, d3a8ib1, d3a8ic1, d3a8id1, d3a8ie_, d3a8if_
    automated match to d1vloa1
    complexed with c2f, po4

Details for d3a8ic2

PDB Entry: 3a8i (more details), 1.99 Å

PDB Description: Crystal Structure of ET-EHred-5-CH3-THF complex
PDB Compounds: (C:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8ic2 b.44.2.0 (C:277-363) automated matches {Escherichia coli [TaxId: 83333]}
teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget
aivqirnrempvkvtkpvfvrngkava

SCOPe Domain Coordinates for d3a8ic2:

Click to download the PDB-style file with coordinates for d3a8ic2.
(The format of our PDB-style files is described here.)

Timeline for d3a8ic2: