| Class b: All beta proteins [48724] (174 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) ![]() |
| Family b.44.2.0: automated matches [231768] (1 protein) not a true family |
| Protein automated matches [231769] (1 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [231770] (2 PDB entries) |
| Domain d3a8ib2: 3a8i B:277-363 [231773] Other proteins in same PDB: d3a8ia1, d3a8ib1, d3a8ic1, d3a8id1, d3a8ie_, d3a8if_ automated match to d1vloa1 complexed with c2f, po4 |
PDB Entry: 3a8i (more details), 1.99 Å
SCOPe Domain Sequences for d3a8ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a8ib2 b.44.2.0 (B:277-363) automated matches {Escherichia coli [TaxId: 83333]}
teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget
aivqirnrempvkvtkpvfvrngkava
Timeline for d3a8ib2: