| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
| Protein automated matches [190218] (13 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [226024] (6 PDB entries) |
| Domain d2xshe2: 2xsh E:180-459 [231580] Other proteins in same PDB: d2xsha1, d2xshb_, d2xshc1, d2xshd_, d2xshe1, d2xshf_, d2xshg1, d2xshh_, d2xshi1, d2xshj_, d2xshk1, d2xshl_ automated match to d2xr8c2 complexed with dc5, fe2, fes |
PDB Entry: 2xsh (more details), 2.29 Å
SCOPe Domain Sequences for d2xshe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xshe2 d.129.3.0 (E:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
Timeline for d2xshe2: