Lineage for d2xshi1 (2xsh I:18-179)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309840Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 1309841Protein automated matches [190701] (8 species)
    not a true protein
  7. 1309842Species Burkholderia xenovorans [TaxId:266265] [226023] (6 PDB entries)
  8. 1309859Domain d2xshi1: 2xsh I:18-179 [231583]
    Other proteins in same PDB: d2xsha2, d2xshb_, d2xshc2, d2xshd_, d2xshe2, d2xshf_, d2xshg2, d2xshh_, d2xshi2, d2xshj_, d2xshk2, d2xshl_
    automated match to d2xr8c1
    complexed with dc5, fe2, fes

Details for d2xshi1

PDB Entry: 2xsh (more details), 2.29 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl
PDB Compounds: (I:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xshi1:

Sequence, based on SEQRES records: (download)

>d2xshi1 b.33.1.0 (I:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d2xshi1 b.33.1.0 (I:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d2xshi1:

Click to download the PDB-style file with coordinates for d2xshi1.
(The format of our PDB-style files is described here.)

Timeline for d2xshi1: