SCOPe 2.08: Domain d2xbbb_: 2xbb B:

Lineage for d2xbbb_ (2xbb B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
   consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation

4. Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families)
   automatically mapped to Pfam PF00632

5. Family d.148.1.0: automated matches [227207] (1 protein)
   not a true family

6. Protein automated matches [226939] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225255] (18 PDB entries)

8. Domain d2xbbb_: 2xbb B: [231567]
   Other proteins in same PDB: d2xbbc_, d2xbbd_
   automated match to d2onia_
   complexed with gol

Details for d2xbbb_

PDB Entry: 2xbb, 2.68 Å

PDB Description: nedd4 hect:ub complex

PDB Compounds: (B:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d2xbbb_:

Sequence; same for both SEQRES and ATOM records:

>d2xbbb_ d.148.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefdg
ekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfig
rvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldlr
fiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffel
ipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdsek
rirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyesf
eelwdklqmaientqg

Timeline for d2xbbb_:

• d2xbbb_ first appeared in SCOPe 2.03
  
• d2xbbb_ appears in SCOPe 2.07