SCOPe 2.08: Domain d1kcwa3: 1kcw A:347-553

Lineage for d1kcwa3 (1kcw A:347-553)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Ceruloplasmin [49559] (1 species)
   consists of 6 domains of this fold
7. Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry)

8. Domain d1kcwa3: 1kcw A:347-553 [23153]
   complexed with cu, nag, o
   has additional insertions and/or extensions that are not grouped together

Details for d1kcwa3

PDB Entry: 1kcw, 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms

PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d1kcwa3:

Sequence, based on SEQRES records:

>d1kcwa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}
irgkhvrhyyiaaeeiiwnyapsgidiftkenltapgsdsavffeqgttriggsykklvy
reytdasftnrkergpeeehlgilgpviwaevgdtirvtfhnkgayplsiepigvrfnkn
negtyyspnynpqsrsvppsashvaptetftyewtvpkevgptnadpvclakmyysavdp
tkdiftgligpmkickkgslhangrqk

Sequence, based on observed residues (ATOM records):

>d1kcwa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}
irgkhvrhyyiaaeeiiwnyapsgidiftkenltapgsdsavffeqgttriggsykklvy
reytdasftnrkergpeeehlgilgpviwaevgdtirvtfhnkgayplsiepigvrfnkn
negtyyspvppsashvaptetftyewtvpkevgptnadpvclakmyysavdptkdiftgl
igpmkickkgslhangrqk

Timeline for d1kcwa3:

• d1kcwa3 first appeared (with stable ids) in SCOP 1.55, called d1kcw_3
  
• d1kcwa3 appears in SCOPe 2.07