SCOP 1.73: Domain d1a65a3: 1a65 A:304-504

Lineage for d1a65a3 (1a65 A:304-504)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)

8. Domain d1a65a3: 1a65 A:304-504 [23150]
   complexed with cu, glc, nag

Details for d1a65a3

PDB Entry: 1a65, 2.23 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus

PDB Compounds: (A:) laccase

SCOP Domain Sequences for d1a65a3:

Sequence; same for both SEQRES and ATOM records:

>d1a65a3 b.6.1.3 (A:304-504) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}
neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq
sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk
rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew
aqlceiyddlppeatsiqtvv

Timeline for d1a65a3:

• d1a65a3 first appeared (with stable ids) in SCOP 1.55
  
• d1a65a3 appears in SCOP 1.71
  
• d1a65a3 appears in SCOP 1.75
  
• d1a65a3 appears in the current release, SCOPe 2.08