Lineage for d1a65a3 (1a65 A:304-504)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11162Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 11197Protein Laccase [49557] (1 species)
  7. 11198Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (1 PDB entry)
  8. 11201Domain d1a65a3: 1a65 A:304-504 [23150]

Details for d1a65a3

PDB Entry: 1a65 (more details), 2.23 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus

SCOP Domain Sequences for d1a65a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a65a3 b.6.1.3 (A:304-504) Laccase {Inky cap fungus (Coprinus cinereus)}
neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq
sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk
rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew
aqlceiyddlppeatsiqtvv

SCOP Domain Coordinates for d1a65a3:

Click to download the PDB-style file with coordinates for d1a65a3.
(The format of our PDB-style files is described here.)

Timeline for d1a65a3: