| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
| Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
| Protein automated matches [190239] (26 species) not a true protein |
| Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries) |
| Domain d2wl9a2: 2wl9 A:135-300 [231438] automated match to d2wl3a2 complexed with fe, gol, mbd, mg |
PDB Entry: 2wl9 (more details), 1.9 Å
SCOPe Domain Sequences for d2wl9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl9a2 d.32.1.0 (A:135-300) automated matches {Rhodococcus sp. [TaxId: 186196]}
pmfgkfvtegqglghiiireddveeatrfyrllglegaveykfalpngavgtpvfmhcnd
rhhslafgvgpmdkrinhlmieythlddlgyahdlvrqqkidvtlqigkhsndealtfyc
anpsgwlwepgwgsrpapaqqehylrdifghdnevegygldiplkg
Timeline for d2wl9a2: