Lineage for d1aspa2 (1asp A:130-338)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940701Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 940702Protein Ascorbate oxidase [49555] (1 species)
    consists of three domains of this fold
  7. 940703Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries)
  8. 940723Domain d1aspa2: 1asp A:130-338 [23143]
    complexed with cu, nag, oh, peo

Details for d1aspa2

PDB Entry: 1asp (more details), 2.59 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms
PDB Compounds: (A:) ascorbate oxidase

SCOPe Domain Sequences for d1aspa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aspa2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
pfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdcsiaakydsn
lepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvveadgnyvqpf
ytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylpnsvsklpts
pppqtpawddfdrsknftyritaamgspk

SCOPe Domain Coordinates for d1aspa2:

Click to download the PDB-style file with coordinates for d1aspa2.
(The format of our PDB-style files is described here.)

Timeline for d1aspa2: