Lineage for d2vu9a2 (2vu9 A:1080-1297)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2402021Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2402084Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2402133Protein automated matches [229100] (6 species)
    not a true protein
  7. 2402157Species Clostridium botulinum [TaxId:36826] [231346] (1 PDB entry)
  8. 2402158Domain d2vu9a2: 2vu9 A:1080-1297 [231347]
    Other proteins in same PDB: d2vu9a1, d2vu9a3
    automated match to d3btaa2
    complexed with mg

Details for d2vu9a2

PDB Entry: 2vu9 (more details), 1.6 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a binding domain in complex with gt1b
PDB Compounds: (A:) botulinum neurotoxin a heavy chain

SCOPe Domain Sequences for d2vu9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vu9a2 b.42.4.2 (A:1080-1297) automated matches {Clostridium botulinum [TaxId: 36826]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerplq

SCOPe Domain Coordinates for d2vu9a2:

Click to download the PDB-style file with coordinates for d2vu9a2.
(The format of our PDB-style files is described here.)

Timeline for d2vu9a2: