SCOPe 2.07: Domain d1asoa2: 1aso A:130-338

Lineage for d1asoa2 (1aso A:130-338)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Ascorbate oxidase [49555] (1 species)
   consists of three domains of this fold

7. Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [49556] (4 PDB entries)

8. Domain d1asoa2: 1aso A:130-338 [23131]
   complexed with cu, nag, oh

Details for d1asoa2

PDB Entry: 1aso, 2.2 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

PDB Compounds: (A:) ascorbate oxidase

SCOPe Domain Sequences for d1asoa2:

Sequence; same for both SEQRES and ATOM records:

>d1asoa2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
pfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdcsiaakydsn
lepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvveadgnyvqpf
ytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylpnsvsklpts
pppqtpawddfdrsknftyritaamgspk

Timeline for d1asoa2:

• d1asoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1asoa2 appears in SCOPe 2.06
  
• d1asoa2 appears in the current release, SCOPe 2.08