Lineage for d2uvia_ (2uvi A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164452Species Yersinia enterocolitica [TaxId:630] [231285] (4 PDB entries)
  8. 2164456Domain d2uvia_: 2uvi A: [231288]
    automated match to d4ovja_
    complexed with ung

Details for d2uvia_

PDB Entry: 2uvi (more details), 2.3 Å

PDB Description: structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with 4,5-unsaturated digalacturonic acid
PDB Compounds: (A:) abc type periplasmic sugar-binding protein

SCOPe Domain Sequences for d2uvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvia_ c.94.1.0 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]}
evnlrmswwggngrhqvtlkaleefhkqhpninvkaeytgwdghlsrlttqiaggtepdv
mqtnwnwlpifskdgtgfynlfsvkeqldlaqfdpkelqqttvngklngipisvtarify
fndatwakagleypktwdellaagkvfkeklgdqyypvvlehqdtlalirsymtqkynip
tideankkfayspeqwvefftmyktmvdnhvmpstkyyasfgksnmyemkpwingewagt
ymwnstitkysdnltkpaklvlgpypmlpgakdaglffkpaqmlsigkstkhpqesamli
nfllnskegvealglergvplsatavtqlrasgvikdedpsvaglnmalelphkmttspy
fddpqivslfgdaiqyidygqktvqetaeyfnkqgdrilkramr

SCOPe Domain Coordinates for d2uvia_:

Click to download the PDB-style file with coordinates for d2uvia_.
(The format of our PDB-style files is described here.)

Timeline for d2uvia_: