| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (45 species) not a true protein |
| Species Roseovarius nubinhibens [TaxId:89187] [225251] (4 PDB entries) |
| Domain d2qddb2: 2qdd B:128-376 [231202] Other proteins in same PDB: d2qdda1, d2qddb1 automated match to d3eeza2 complexed with gol |
PDB Entry: 2qdd (more details), 2.3 Å
SCOPe Domain Sequences for d2qddb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qddb2 c.1.11.0 (B:128-376) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
eaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiarieaisaglpd
ghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpimldeclhef
sdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggtaladtaalhl
aastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpealgrpvasy
deghhhhhh
Timeline for d2qddb2: