Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries) |
Domain d2qddb1: 2qdd B:2-127 [231201] Other proteins in same PDB: d2qdda2, d2qdda3, d2qdda4, d2qddb2, d2qddb3, d2qddb4 automated match to d3eeza1 complexed with gol |
PDB Entry: 2qdd (more details), 2.3 Å
SCOPe Domain Sequences for d2qddb1:
Sequence, based on SEQRES records: (download)
>d2qddb1 d.54.1.0 (B:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} ritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsylpah gpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglpl wqllgg
>d2qddb1 d.54.1.0 (B:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} ritrltvfhldlplakpfdrldstylridtdegvtgwgegcpwghsylpahgpglragia tlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglplwqllgg
Timeline for d2qddb1:
View in 3D Domains from other chains: (mouse over for more information) d2qdda1, d2qdda2, d2qdda3, d2qdda4 |