Lineage for d2q9ua1 (2q9u A:4-253)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603336Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
  6. 2603337Protein Nitric oxide reductase N-terminal domain [143914] (2 species)
  7. 2603338Species Giardia intestinalis [TaxId:5741] [231191] (1 PDB entry)
  8. 2603339Domain d2q9ua1: 2q9u A:4-253 [231192]
    Other proteins in same PDB: d2q9ua2, d2q9ub2
    automated match to d1ycfa2
    complexed with feo, fmn, no3

Details for d2q9ua1

PDB Entry: 2q9u (more details), 1.9 Å

PDB Description: Crystal structure of the flavodiiron protein from Giardia intestinalis
PDB Compounds: (A:) A-type flavoprotein

SCOPe Domain Sequences for d2q9ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9ua1 d.157.1.3 (A:4-253) Nitric oxide reductase N-terminal domain {Giardia intestinalis [TaxId: 5741]}
kpkyvqdqemipgvywvgivdwmvrifhgyhtdegssynsyfiddecptvidsvkypfae
ewlsriaaccpldkikyvvmnhaegdhasslkdhyhkftnatfvctkkcqehlkilygme
katwlivddkytlkigkrtlkfipvpllhwpdstftycpedkilfsndgfgqhyatsrrw
adecdvshvmhlfkeytanilglfsaqmrkalevastveikyilsahgvswrgdamglai
aeydrwskgq

SCOPe Domain Coordinates for d2q9ua1:

Click to download the PDB-style file with coordinates for d2q9ua1.
(The format of our PDB-style files is described here.)

Timeline for d2q9ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q9ua2