Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Roseovarius sp. [TaxId:314265] [231165] (1 PDB entry) |
Domain d2pmqa2: 2pmq A:126-367 [231166] Other proteins in same PDB: d2pmqa1, d2pmqa3, d2pmqb1, d2pmqb3 automated match to d4mggf2 complexed with mg |
PDB Entry: 2pmq (more details), 1.72 Å
SCOPe Domain Sequences for d2pmqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmqa2 c.1.11.0 (A:126-367) automated matches {Roseovarius sp. [TaxId: 314265]} altdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairkvweavrg tgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhalymdedgt slntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggdivsaact hiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidperfgpplf sa
Timeline for d2pmqa2: