Lineage for d1bq5a2 (1bq5 A:160-340)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114921Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 1115044Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 1115297Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (23 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 1115343Domain d1bq5a2: 1bq5 A:160-340 [23111]
    complexed with cu

Details for d1bq5a2

PDB Entry: 1bq5 (more details), 2.05 Å

PDB Description: nitrite reductase from alcaligenes xylosoxidans gifu 1051
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1bq5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq5a2 b.6.1.3 (A:160-340) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
dglkdpqgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshiv
fngkvgaltgadaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdle
twfirggsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapap
i

SCOPe Domain Coordinates for d1bq5a2:

Click to download the PDB-style file with coordinates for d1bq5a2.
(The format of our PDB-style files is described here.)

Timeline for d1bq5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bq5a1