![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
![]() | Species Alcaligenes xylosoxidans [TaxId:85698] [419328] (24 PDB entries) Uniprot O68601 |
![]() | Domain d1bq5a1: 1bq5 A:8-159 [23110] Other proteins in same PDB: d1bq5a2 complexed with cu |
PDB Entry: 1bq5 (more details), 2.05 Å
SCOPe Domain Sequences for d1bq5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bq5a1 b.6.1.3 (A:8-159) Nitrite reductase, NIR, N-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]} dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad rsgtfvyhcapegmvpwhvvsgmsgtlmvlpr
Timeline for d1bq5a1: