Lineage for d2oj6b1 (2oj6 B:313-455)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386700Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins)
  6. 2386706Protein automated matches [231033] (1 species)
    not a true protein
  7. 2386707Species Reovirus sp. [TaxId:10891] [231036] (2 PDB entries)
  8. 2386715Domain d2oj6b1: 2oj6 B:313-455 [231041]
    Other proteins in same PDB: d2oj6c1
    automated match to d1kkea2
    complexed with mg; mutant

Details for d2oj6b1

PDB Entry: 2oj6 (more details), 1.85 Å

PDB Description: crystal structure of reovirus t3d attachment protein sigma1 head domain d345n mutant
PDB Compounds: (B:) Viral attachment protein sigma 1

SCOPe Domain Sequences for d2oj6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oj6b1 b.21.1.2 (B:313-455) automated matches {Reovirus sp. [TaxId: 10891]}
yrfrqsmwigivsysgsglnwrvqvnsdifivndyihiclpafdgfsiadggdlslnfvt
gllpplltgdtepafhndvvtygaqtvaiglssggtpqymsknlwveqwqdgvlrlrveg
ggsithsnskwpamtvsyprsft

SCOPe Domain Coordinates for d2oj6b1:

Click to download the PDB-style file with coordinates for d2oj6b1.
(The format of our PDB-style files is described here.)

Timeline for d2oj6b1: