SCOPe 2.07: Domain d2jahc_: 2jah C:

Lineage for d2jahc_ (2jah C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Streptomyces clavuligerus [TaxId:1901] [230898] (2 PDB entries)

8. Domain d2jahc_: 2jah C: [230899]
   automated match to d3l77a_
   complexed with ndp

Details for d2jahc_

PDB Entry: 2jah, 1.8 Å

PDB Description: biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus

PDB Compounds: (C:) clavulanic acid dehydrogenase

SCOPe Domain Sequences for d2jahc_:

Sequence; same for both SEQRES and ATOM records:

>d2jahc_ c.2.1.0 (C:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
psalqgkvalitgassgigeataralaaegaavaiaarrveklralgdeltaagakvhvl
eldvadrqgvdaavastvealggldilvnnagimllgpvedadttdwtrmidtnllglmy
mtraalphllrskgtvvqmssiagrvnvrnaavyqatkfgvnafsetlrqevtergvrvv
viepgttdtelrghithtatkemyeqrisqirklqaqdiaeavryavtaphhatvheifi
rptdqv

Timeline for d2jahc_:

• d2jahc_ first appeared in SCOPe 2.03
  
• d2jahc_ appears in SCOPe 2.06
  
• d2jahc_ appears in the current release, SCOPe 2.08