SCOPe 2.07: Domain d2iuka1: 2iuk A:8-175

Lineage for d2iuka1 (2iuk A:8-175)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225161] (2 PDB entries)

8. Domain d2iuka1: 2iuk A:8-175 [230790]
   Other proteins in same PDB: d2iuka2, d2iukb2
   automated match to d1n8qa2
   complexed with fe

Details for d2iuka1

PDB Entry: 2iuk, 2.4 Å

PDB Description: crystal structure of soybean lipoxygenase-d

PDB Compounds: (A:) seed lipoxygenase

SCOPe Domain Sequences for d2iuka1:

Sequence, based on SEQRES records:

>d2iuka1 b.12.1.0 (A:8-175) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gqkikgtvvlmpknvldfnaitsigkggvidtatgilgqgvslvggvidtatsflgrnis
mqlisatqtdgsgngkvgkevylekhlptlptlgarqdafsiffewdasfgipgafyikn
fmtdefflvsvkledipnhgtiefvcnswvynfrsykknriffvndty

Sequence, based on observed residues (ATOM records):

>d2iuka1 b.12.1.0 (A:8-175) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gqkikgtvvlmpknvldfnaitsividtatsflgrnismqlisatqtdgsgngkvgkevy
lekhlptlptlgarqdafsiffewdasfgipgafyiknfmtdefflvsvkledipnhgti
efvcnswvynfrsykknriffvndty

Timeline for d2iuka1:

• d2iuka1 first appeared in SCOPe 2.03
  
• d2iuka1 appears in SCOPe 2.06
  
• d2iuka1 appears in the current release, SCOPe 2.08