SCOPe 2.07: Domain d1as8c2: 1as8 C:167-339

Lineage for d1as8c2 (1as8 C:167-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries)
   Uniprot P38501

8. Domain d1as8c2: 1as8 C:167-339 [23079]
   complexed with cu, no2

Details for d1as8c2

PDB Entry: 1as8, 1.85 Å

PDB Description: structure of nitrite bound to reduced alcaligenes faecalis nitrite reductase at cryo temperature

PDB Compounds: (C:) nitrite reductase

SCOPe Domain Sequences for d1as8c2:

Sequence; same for both SEQRES and ATOM records:

>d1as8c2 b.6.1.3 (C:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d1as8c2:

• d1as8c2 first appeared (with stable ids) in SCOP 1.55
  
• d1as8c2 appears in SCOPe 2.06
  
• d1as8c2 appears in the current release, SCOPe 2.08