Lineage for d2i79f_ (2i79 F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2576030Species Streptococcus pneumoniae [TaxId:170187] [225152] (1 PDB entry)
  8. 2576036Domain d2i79f_: 2i79 F: [230782]
    automated match to d2i79d_
    complexed with aco

Details for d2i79f_

PDB Entry: 2i79 (more details), 2.1 Å

PDB Description: The crystal structure of the acetyltransferase of GNAT family from Streptococcus pneumoniae
PDB Compounds: (F:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2i79f_:

Sequence, based on SEQRES records: (download)

>d2i79f_ d.108.1.0 (F:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
yellireaepkdaaelvaflnrvsletdftsldgdgilltseemeiflnkqassdnqitl
laflngkiagivnitadqrkrvrhigdlfivigkrywnnglgsllleeaiewaqasgilr
rlqltvqtrnqaavhlyqkhgfviegsqergayieegkfidvylmgklig

Sequence, based on observed residues (ATOM records): (download)

>d2i79f_ d.108.1.0 (F:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
yellireaepkdaaelvaflnrvsletdftsldgdgilltseemeiflnkqassdnqitl
laflngkiagivnitadqrkrvrhigdlfivigkrywnnglgsllleeaiewaqasgilr
rlqltvqtrnqaavhlyqkhgfviegsqergayiekfidvylmgklig

SCOPe Domain Coordinates for d2i79f_:

Click to download the PDB-style file with coordinates for d2i79f_.
(The format of our PDB-style files is described here.)

Timeline for d2i79f_: