Lineage for d2huzb_ (2huz B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1921882Species Human (Homo sapiens) [TaxId:9606] [225745] (14 PDB entries)
  8. 1921913Domain d2huzb_: 2huz B: [230776]
    automated match to d4ag7a_

Details for d2huzb_

PDB Entry: 2huz (more details), 2.67 Å

PDB Description: Crystal structure of GNPNAT1
PDB Compounds: (B:) Glucosamine 6-phosphate N-acetyltransferase

SCOPe Domain Sequences for d2huzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huzb_ d.108.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlte
tgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrvedv
vvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrrf
lk

SCOPe Domain Coordinates for d2huzb_:

Click to download the PDB-style file with coordinates for d2huzb_.
(The format of our PDB-style files is described here.)

Timeline for d2huzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2huza_