Lineage for d2egza_ (2egz A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573115Species Aquifex aeolicus [TaxId:63363] [187668] (3 PDB entries)
  8. 1573116Domain d2egza_: 2egz A: [230703]
    automated match to d3l9cb_
    complexed with tla

Details for d2egza_

PDB Entry: 2egz (more details), 1.75 Å

PDB Description: Crystal structure of the 3-dehydroquinate dehydratase from Aquifex aeolicus VF5
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2egza_:

Sequence, based on SEQRES records: (download)

>d2egza_ c.1.10.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mliavplddtnfsenlkkakekgadivelrvdqfsdtslnyvkekleevhsqglktilti
rspeeggrevknreelfeelsplsdytdielssrgllvklynitkeagkkliisyhnfel
tppnwiirevlregyryggipkiavkansyedvarllcisrqvegekilismgdygkisr
lagyvfgsvitycslekafapgqipleemvelrkkfyrl

Sequence, based on observed residues (ATOM records): (download)

>d2egza_ c.1.10.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mliavplddtnfsenlkkakekgadivelrvdqfsdtslnyvkekleevhsqglktilti
rspeeggrevknreelfeelsplsdytdielssrgllvklynitkeagkkliisyhnfel
tppnwiirevlregyryggipkiavkansyedvarllcisrqvegekilismgdygkisr
lagyvfgsvitycsleapgqipleemvelrkkfyrl

SCOPe Domain Coordinates for d2egza_:

Click to download the PDB-style file with coordinates for d2egza_.
(The format of our PDB-style files is described here.)

Timeline for d2egza_: