Lineage for d2e0aa2 (2e0a A:188-386)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1925132Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1925133Protein automated matches [226867] (13 species)
    not a true protein
  7. 1925176Species Human (Homo sapiens) [TaxId:9606] [225008] (10 PDB entries)
  8. 1925177Domain d2e0aa2: 2e0a A:188-386 [230684]
    Other proteins in same PDB: d2e0aa1, d2e0ab1
    automated match to d1jm6a2
    complexed with anp, mg

Details for d2e0aa2

PDB Entry: 2e0a (more details), 1.86 Å

PDB Description: Crystal structure of human pyruvate dehydrogenase kinase 4 in complex with AMPPNP
PDB Compounds: (A:) Pyruvate dehydrogenase kinase isozyme 4

SCOPe Domain Sequences for d2e0aa2:

Sequence, based on SEQRES records: (download)

>d2e0aa2 d.122.1.0 (A:188-386) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
sytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkal
ssesieklpvfnksafkhy

Sequence, based on observed residues (ATOM records): (download)

>d2e0aa2 d.122.1.0 (A:188-386) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
sytystaptpnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesie
klpvfnksafkhy

SCOPe Domain Coordinates for d2e0aa2:

Click to download the PDB-style file with coordinates for d2e0aa2.
(The format of our PDB-style files is described here.)

Timeline for d2e0aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e0aa1