SCOPe 2.04: Domain d2e0aa2: 2e0a A:188-386

Lineage for d2e0aa2 (2e0a A:188-386)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225008] (10 PDB entries)

8. Domain d2e0aa2: 2e0a A:188-386 [230684]
   Other proteins in same PDB: d2e0aa1, d2e0ab1
   automated match to d1jm6a2
   complexed with anp, mg

Details for d2e0aa2

PDB Entry: 2e0a, 1.86 Å

PDB Description: Crystal structure of human pyruvate dehydrogenase kinase 4 in complex with AMPPNP

PDB Compounds: (A:) Pyruvate dehydrogenase kinase isozyme 4

SCOPe Domain Sequences for d2e0aa2:

Sequence, based on SEQRES records:

>d2e0aa2 d.122.1.0 (A:188-386) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
sytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkal
ssesieklpvfnksafkhy

Sequence, based on observed residues (ATOM records):

>d2e0aa2 d.122.1.0 (A:188-386) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
sytystaptpnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesie
klpvfnksafkhy

Timeline for d2e0aa2:

• d2e0aa2 first appeared in SCOPe 2.03
  
• d2e0aa2 appears in SCOPe 2.05
  
• d2e0aa2 appears in the current release, SCOPe 2.08