| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins) contains Pfam PF00929 |
| Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
| Species Bacteriophage RB69 [TaxId:12353] [53127] (92 PDB entries) additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold |
| Domain d2dtuc1: 2dtu C:1-375 [230655] Other proteins in same PDB: d2dtua2, d2dtub2, d2dtuc2, d2dtud2 automated match to d1ih7a1 protein/DNA complex |
PDB Entry: 2dtu (more details), 2.37 Å
SCOPe Domain Sequences for d2dtuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtuc1 c.55.3.5 (C:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvgeiitlfgisvldyidlykkfsftnqpsysldyisefelnvgklkydg
pisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfspiktwda
iifnslke
Timeline for d2dtuc1: