SCOPe 2.05: Domain d2boqa_: 2boq A:

Lineage for d2boqa_ (2boq A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (10 species)
   not a true protein

7. Species Pleurotus eryngii [TaxId:5323] [226503] (17 PDB entries)

8. Domain d2boqa_: 2boq A: [230535]
   automated match to d4fcna_
   complexed with ca, cac, hem, mn, zn

Details for d2boqa_

PDB Entry: 2boq, 1.33 Å

PDB Description: crystal structure of versatile peroxidase

PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d2boqa_:

Sequence; same for both SEQRES and ATOM records:

>d2boqa_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadp

Timeline for d2boqa_:

• d2boqa_ first appeared in SCOPe 2.03
  
• d2boqa_ appears in SCOPe 2.04
  
• d2boqa_ appears in SCOPe 2.06
  
• d2boqa_ appears in the current release, SCOPe 2.08