| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
| Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries) |
| Domain d1niea1: 1nie A:8-166 [23052] Other proteins in same PDB: d1niea2 complexed with cu |
PDB Entry: 1nie (more details), 1.9 Å
SCOPe Domain Sequences for d1niea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1niea1 b.6.1.3 (A:8-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d1niea1: