Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) |
Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins) Pfam PF02080 |
Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species) |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries) |
Domain d2aema2: 2aem A:245-338 [230509] Other proteins in same PDB: d2aema1 automated match to d2fy8a2 |
PDB Entry: 2aem (more details), 2.8 Å
SCOPe Domain Sequences for d2aema2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aema2 d.286.1.1 (A:245-338) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisalv
Timeline for d2aema2: