| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
| Protein Potassium channel-related protein MthK [75122] (1 species) |
| Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (5 PDB entries) |
| Domain d2aeja1: 2aej A:116-244 [230504] Other proteins in same PDB: d2aeja2, d2aeja3, d2aejb2 automated match to d1lnqa3 |
PDB Entry: 2aej (more details), 2.1 Å
SCOPe Domain Sequences for d2aeja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aeja1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid
Timeline for d2aeja1: