SCOPe 2.07: Domain d1zy0a1: 1zy0 A:2-190

Lineage for d1zy0a1 (1zy0 A:2-190)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230479] (5 PDB entries)

8. Domain d1zy0a1: 1zy0 A:2-190 [230482]
   Other proteins in same PDB: d1zy0a2, d1zy0b2
   automated match to d3g5ka_
   complexed with zn

Details for d1zy0a1

PDB Entry: 1zy0, 2.9 Å

PDB Description: X-ray structure of peptide deformylase from Arabidopsis thaliana (AtPDF1A); crystals grown in PEG-6000

PDB Compounds: (A:) Peptide deformylase, mitochondrial

SCOPe Domain Sequences for d1zy0a1:

Sequence; same for both SEQRES and ATOM records:

>d1zy0a1 d.167.1.0 (A:2-190) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dlpeivasgdpvlhekarevdpgeigseriqkiiddmikvmrlapgvglaapqigvplri
ivledtkeyisyapkeeilaqerrhfdlmvmvnpvlkersnkkalffegclsvdgfraav
erylevvvtgydrqgkrievnasgwqarilqhecdhldgnlyvdkmvprtfrtvdnldlp
laegcpklg

Timeline for d1zy0a1:

• d1zy0a1 first appeared in SCOPe 2.03, called d1zy0a_
  
• d1zy0a1 appears in SCOPe 2.06
  
• d1zy0a1 appears in the current release, SCOPe 2.08