Lineage for d1zlvl2 (1zlv L:108-212)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763068Domain d1zlvl2: 1zlv L:108-212 [230448]
    Other proteins in same PDB: d1zlvh1, d1zlvh2, d1zlvk1, d1zlvl1, d1zlvm1, d1zlvm2
    automated match to d1n0xl2
    complexed with man

Details for d1zlvl2

PDB Entry: 1zlv (more details), 2.33 Å

PDB Description: fab 2g12 + man7
PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zlvl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlvl2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1zlvl2:

Click to download the PDB-style file with coordinates for d1zlvl2.
(The format of our PDB-style files is described here.)

Timeline for d1zlvl2: