![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
![]() | Domain d1yc8b1: 1yc8 B:2-116 [230416] Other proteins in same PDB: d1yc8a2, d1yc8b2 automated match to d1yzzb_ mutant |
PDB Entry: 1yc8 (more details), 2.7 Å
SCOPe Domain Sequences for d1yc8b1:
Sequence, based on SEQRES records: (download)
>d1yc8b1 b.1.1.1 (B:2-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} vqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyqd svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtv
>d1yc8b1 b.1.1.1 (B:2-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} vqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgglewvssisspgtiyyqds vkgrftisrdnakntvylqmnslqredtgmyycqiqcrsireywgqgtqvtv
Timeline for d1yc8b1: