Lineage for d1yc8b1 (1yc8 B:2-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742169Domain d1yc8b1: 1yc8 B:2-116 [230416]
    Other proteins in same PDB: d1yc8a2, d1yc8b2
    automated match to d1yzzb_
    mutant

Details for d1yc8b1

PDB Entry: 1yc8 (more details), 2.7 Å

PDB Description: caban33- y37v/e44g/r45l triple mutant
PDB Compounds: (B:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yc8b1:

Sequence, based on SEQRES records: (download)

>d1yc8b1 b.1.1.1 (B:2-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyqd
svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtv

Sequence, based on observed residues (ATOM records): (download)

>d1yc8b1 b.1.1.1 (B:2-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgglewvssisspgtiyyqds
vkgrftisrdnakntvylqmnslqredtgmyycqiqcrsireywgqgtqvtv

SCOPe Domain Coordinates for d1yc8b1:

Click to download the PDB-style file with coordinates for d1yc8b1.
(The format of our PDB-style files is described here.)

Timeline for d1yc8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yc8b2