SCOPe 2.07: Domain d1y51b_: 1y51 B:

Lineage for d1y51b_ (1y51 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Geobacillus stearothermophilus [TaxId:1422] [230401] (3 PDB entries)

8. Domain d1y51b_: 1y51 B: [230407]
   automated match to d1qfra_
   complexed with so4; mutant

Details for d1y51b_

PDB Entry: 1y51, 1.65 Å

PDB Description: x-ray crystal structure of bacillus stearothermophilus histidine phosphocarrier protein (hpr) f29w mutant

PDB Compounds: (B:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1y51b_:

Sequence; same for both SEQRES and ATOM records:

>d1y51b_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Geobacillus stearothermophilus [TaxId: 1422]}
aektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgati
kitaegadaaeamaaltdtlakeglae

Timeline for d1y51b_:

• d1y51b_ first appeared in SCOPe 2.03
  
• d1y51b_ appears in SCOPe 2.06
  
• d1y51b_ appears in the current release, SCOPe 2.08