Lineage for d1sovb2 (1sov B:164-331)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939427Species Toxoplasma gondii [TaxId:5811] [230334] (2 PDB entries)
  8. 1939429Domain d1sovb2: 1sov B:164-331 [230338]
    Other proteins in same PDB: d1sova1, d1sovb1
    automated match to d1pzgc2

Details for d1sovb2

PDB Entry: 1sov (more details), 1.9 Å

PDB Description: Toxoplasma gondii bradyzoite-specific LDH (LDH2) apo form
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1sovb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sovb2 d.162.1.0 (B:164-331) automated matches {Toxoplasma gondii [TaxId: 5811]}
anvldsarfrrfiadqleisprdiqatvigthgdhmlplaryvtvngfplrefikkgkmt
eaklaeivertkkaggeivrllgqgsayyapalsaitmaqaflkdekrvlpcsvycqgey
glhdmfiglpaviggggieqvieleltheeqecfrksvddvvelnkslaal

SCOPe Domain Coordinates for d1sovb2:

Click to download the PDB-style file with coordinates for d1sovb2.
(The format of our PDB-style files is described here.)

Timeline for d1sovb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sovb1