SCOPe 2.05: Domain d1sovb2: 1sov B:164-331

Lineage for d1sovb2 (1sov B:164-331)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [230334] (2 PDB entries)

8. Domain d1sovb2: 1sov B:164-331 [230338]
   Other proteins in same PDB: d1sova1, d1sovb1
   automated match to d1pzgc2

Details for d1sovb2

PDB Entry: 1sov, 1.9 Å

PDB Description: Toxoplasma gondii bradyzoite-specific LDH (LDH2) apo form

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1sovb2:

Sequence; same for both SEQRES and ATOM records:

>d1sovb2 d.162.1.0 (B:164-331) automated matches {Toxoplasma gondii [TaxId: 5811]}
anvldsarfrrfiadqleisprdiqatvigthgdhmlplaryvtvngfplrefikkgkmt
eaklaeivertkkaggeivrllgqgsayyapalsaitmaqaflkdekrvlpcsvycqgey
glhdmfiglpaviggggieqvieleltheeqecfrksvddvvelnkslaal

Timeline for d1sovb2:

• d1sovb2 first appeared in SCOPe 2.03
  
• d1sovb2 appears in SCOPe 2.04
  
• d1sovb2 appears in SCOPe 2.06
  
• d1sovb2 appears in the current release, SCOPe 2.08