![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Brucella suis [TaxId:204722] [230314] (1 PDB entry) |
![]() | Domain d4o5oa1: 4o5o A:1-255 [230315] Other proteins in same PDB: d4o5oa2, d4o5ob2 automated match to d4dmla_ complexed with edo, trs, zn |
PDB Entry: 4o5o (more details), 1.4 Å
SCOPe Domain Sequences for d4o5oa1:
Sequence, based on SEQRES records: (download)
>d4o5oa1 c.2.1.0 (A:1-255) automated matches {Brucella suis [TaxId: 204722]} mqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarfqrtdv asdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtisinligtfn mlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpvarela rhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvhhivenqmln gevirldgalrmaak
>d4o5oa1 c.2.1.0 (A:1-255) automated matches {Brucella suis [TaxId: 204722]} mqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarfqrtdv asdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtisinligtfn mlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpvarela rhgirvmtiapgifktpmmavqdalgasvpfpprlgepaeyaalvhhivenqmlngevir ldgalrmaak
Timeline for d4o5oa1: