Lineage for d1ocrb1 (1ocr B:91-227)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114862Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 1114863Protein Cytochrome c oxidase [49544] (4 species)
  7. 1114864Species Cow (Bos taurus) [TaxId:9913] [49545] (14 PDB entries)
  8. 1114881Domain d1ocrb1: 1ocr B:91-227 [23029]
    Other proteins in same PDB: d1ocra_, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
    complexed with cu, hea, mg, na, zn

Details for d1ocrb1

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d1ocrb1:

Click to download the PDB-style file with coordinates for d1ocrb1.
(The format of our PDB-style files is described here.)

Timeline for d1ocrb1: