Lineage for d2occb1 (2occ B:91-227)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774690Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1774691Protein Cytochrome c oxidase [49544] (4 species)
  7. 1774692Species Cow (Bos taurus) [TaxId:9913] [49545] (26 PDB entries)
  8. 1774727Domain d2occb1: 2occ B:91-227 [23027]
    Other proteins in same PDB: d2occa_, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
    complexed with cu, hea, mg, na, per, zn

Details for d2occb1

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d2occb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d2occb1:

Click to download the PDB-style file with coordinates for d2occb1.
(The format of our PDB-style files is described here.)

Timeline for d2occb1: