SCOPe 2.08: Domain d1fftg1: 1fft G:118-283

Lineage for d1fftg1 (1fft G:118-283)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Quinol oxidase (CyoA) [49542] (1 species)

7. Species Escherichia coli [TaxId:562] [49543] (4 PDB entries)

8. Domain d1fftg1: 1fft G:118-283 [23026]
   Other proteins in same PDB: d1ffta_, d1fftb2, d1fftc2, d1fftc3, d1fftf_, d1fftg2, d1ffth2, d1ffth3
   complexed with cu, hem, heo

Details for d1fftg1

PDB Entry: 1fft, 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

PDB Compounds: (G:) ubiquinol oxidase

SCOPe Domain Sequences for d1fftg1:

Sequence; same for both SEQRES and ATOM records:

>d1fftg1 b.6.1.2 (G:118-283) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma

Timeline for d1fftg1:

• d1fftg1 first appeared (with stable ids) in SCOP 1.55
  
• d1fftg1 appears in SCOPe 2.07