Lineage for d1jera_ (1jer A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1302648Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1303129Protein Stellacyanin [49539] (1 species)
  7. 1303130Species Cucumber (Cucumis sativus) [TaxId:3659] [49540] (1 PDB entry)
  8. 1303131Domain d1jera_: 1jer A: [23022]
    CASP2
    complexed with cu

Details for d1jera_

PDB Entry: 1jer (more details), 1.6 Å

PDB Description: cucumber stellacyanin, cu2+, ph 7.0
PDB Compounds: (A:) cucumber stellacyanin

SCOPe Domain Sequences for d1jera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]}
mqstvhivgdntgwsvpsspnfysqwaagktfrvgdslqfnfpanahnvhemetkqsfda
cnfvnsdndvertspvierldelgmhyfvctvgthcsngqklsinvvaan

SCOPe Domain Coordinates for d1jera_:

Click to download the PDB-style file with coordinates for d1jera_.
(The format of our PDB-style files is described here.)

Timeline for d1jera_: